Share this post on:

Product Name :
LL – 37, reverse sequence

CAS NO. :

Formula :

Molecular Weight::
4493.37

Target:

Serial Number:
Ser-Glu-Thr-Arg-Pro-Val-Leu-Asn-Arg-Leu-Phe-Asp-Lys-Ile-Arg-Gln-Val-Ile-Arg-Lys-Phe-Glu-Lys-Gly-Ile-Lys-Glu-Lys-Ser-Lys-Arg-Phe-Phe-Asp-Gly-Leu-Leu

Short serial number :
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

Purity:
≥95%

Description :

References:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Cy3-conjugated AffiniPure Goat Anti-Rabbit IgG H&L
Phospho-PTEN (Ser380) Antibody
Phospho-Cyclin E1 (Thr395) Antibody: Phospho-Cyclin E1 (Thr395) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 47 kDa, targeting to Phospho-Cyclin E1 (Thr395). It can be used for WB assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna