Share this post on:

Product Name :
Parathyroid Hormone(1-34), bovine

CAS NO. :
125580-28-1

Formula :
C183H288N54O50S2

Molecular Weight::
4108.71

Target:
Thyroid Hormone Receptor

Serial Number:
Ala-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

Short serial number :
AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF

Purity:
95%

Description :
Parathyroid hormone (1-34) (bovine) is a parathyroid hormone (PTH) receptor agonist. It increases calcium and inorganic phosphate levels in the serum of young rats. Parathyroid hormone (PTH) is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid, which is secreted by the chief cell of the parathyroid glands as a polypeptide containing 84 amino acids.

References:
[1]. A gamma-glutamyl peptide isolated from onion (Allium cepa L.) by bioassay-guided fractionation inhibits resorption activity of osteoclasts. [2]. SAR of carbon-linked, 2-substituted purines: synthesis and characterization of AP23451 as a novel bone-targeted inhibitor of Src tyrosine kinase with in vivo anti-resorptive activity. [3]. Parathyroid hormone regulates the distribution and osteoclastogenic potential of hematopoietic progenitors in the bone marrow. [4].A DNA segment spanning the mouse Tnfsf11 transcription unit and its upstream regulatory domain rescues the pleiotropic biologic phenotype of the RANKL null mouse.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
PFKFB3 Antibody
CD68 Antibody (YA529)
MCU Antibody: MCU Antibody is a non-conjugated and Mouse origined monoclonal antibody about 40 kDa, targeting to MCU. It can be used for WB,FC assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna