Name :
Kitl (Mouse) Recombinant Protein
Biological Activity :
Mouse Kitl (P20826, 26 a.a. – 189 a.a.) partial recombinant protein expressed in Pichia pastoris.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
P20826
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=17311
Amino Acid Sequence :
MTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Molecular Weight :
18.4
Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Yeast
Interspecies Antigen Sequence :
Preparation Method :
Pichia pastoris expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Kitl
Gene Alias :
Clo, Con, Gb, Kitlg, Mgf, SCF, SF, SLF, Sl, Steel, contrasted
Gene Description :
kit ligand
Gene Summary :
Other Designations :
OTTMUSP00000022753|Steel factor|cloud gray|grizzle-belly|mast cell growth factor|stem cell factor
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Fractalkine/CX3CL1 Proteincustom synthesis
IL-7 Proteinmanufacturer
Popular categories:
CD11c/Integrin alpha X
N-Cadherin/CD325
