Name :
IL17A (Canine) Recombinant Protein
Biological Activity :
Canine IL17A (C6L8D7, 29 a.a. – 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
C6L8D7
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=481837
Amino Acid Sequence :
FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVAHHHHHH
Molecular Weight :
15.6
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Mammals
Interspecies Antigen Sequence :
Preparation Method :
Mammalian cell (HEK293) expression system
Purification :
Quality Control Testing :
Storage Buffer :
In PBS pH 7.4 (10% glycerol)
Applications :
Functional Study， SDS-PAGE，
Gene Name :
IL17A
Gene Alias :
–
Gene Description :
interleukin 17A
Gene Summary :
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Growth Differentiation Factor Recombinant Proteins
IL-18BP ProteinSource
Popular categories:
CD74
Angiopoietin Like 2
