Name :
FGF1 (Human) Recombinant Protein
Biological Activity :
Human FGF1 recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q53ZZ1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2246
Amino Acid Sequence :
MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular Weight :
15.8
Storage and Stability :
Stored at 4°C for 2-4 weeks, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Chromatography
Quality Control Testing :
Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH2O to 0.1mg-0.25mg/mL. Allow sample to sit for 5 min at 4 °C, spin to remove precipitant.
Applications :
Functional Study,
Gene Name :
FGF1
Gene Alias :
AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1
Gene Description :
fibroblast growth factor 1 (acidic)
Gene Summary :
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq
Other Designations :
OTTHUMP00000066028|OTTHUMP00000066030|OTTHUMP00000066031|OTTHUMP00000174675|endothelial cell growth factor, alpha|endothelial cell growth factor, beta|heparin-binding growth factor 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF Proteinsupplier
IL-10 Proteincustom synthesis
Popular categories:
Biotinylated Proteins
Bacterial/Fungal Proteins
