Share this post on:

Name :
FLT3LG (Human) Recombinant Protein

Biological Activity :
Human FLT3LG recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P49771

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2323

Amino Acid Sequence :
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Molecular Weight :
17.6

Storage and Stability :
Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
chromatographic

Quality Control Testing :

Storage Buffer :
The protein was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.

Applications :
Functional Study,

Gene Name :
FLT3LG

Gene Alias :
FL

Gene Description :
fms-related tyrosine kinase 3 ligand

Gene Summary :

Other Designations :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Integrin Associated Protein/CD47 medchemexpress
OSM ProteinStorage & Stability
Popular categories:
SARS-CoV-2 S1 Protein
cAMP-Dependent Protein Kinase A Inhibitor gamma

Share this post on:

Author: DNA_ Alkylatingdna