Name :
Cxcl14 (Mouse) Recombinant Protein
Biological Activity :
Mouse Cxcl14 (Q9WUQ5, 23 a.a. – 99 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q9WUQ5
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=57266
Amino Acid Sequence :
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Molecular Weight :
9.4
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water is > 100 ug/mL
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Cxcl14
Gene Alias :
1110031L23Rik, 1200006I23Rik, AI414372, BMAC, BRAK, KS1, Kec, MGC90667, MIP-2g, MIP2gamma, NJAC, Scyb14, bolekine
Gene Description :
chemokine (C-X-C motif) ligand 14
Gene Summary :
member 14
Other Designations :
kidney-expressed chemokine CXC|musculus CXC chemokine MIP-2gamma|small inducible cytokine subfamily B (Cys-X-Cys), member 14
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Integrin Associated Protein/CD47 Recombinant Proteins
B7-1/CD80 ProteinBiological Activity
Popular categories:
IL-18R alpha
CD85i/LIR-6
