Name :
CDO1 (Human) Recombinant Protein
Biological Activity :
Human CDO1 (Q16878, 1 a.a. – 170 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
Q16878
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1036
Amino Acid Sequence :
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQR
Molecular Weight :
23.9
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
In 20mM Tris-HCl pH 8.0 (1 mM DTT and 10% glycerol)
Applications :
SDS-PAGE，
Gene Name :
CDO1
Gene Alias :
–
Gene Description :
cysteine dioxygenase, type I
Gene Summary :
O
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Vitronectin medchemexpress
IL-15 ProteinBiological Activity
Popular categories:
UEV-1
Integrin alpha 8 beta 1
