Share this post on:

Product Name :
Helospectin I

CAS NO. :
93438-37-0

Formula :
C183H293N47O59

Molecular Weight::
4095.66

Target:
others

Serial Number:
His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser-Ser

Short serial number :
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS

Purity:
≥95%

Description :
Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

References:
[1]. Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. 2004 Jan;25(1):65-9. [2]. Grundemar L, et al. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br J Pharmacol. 1990 Mar;99(3):526-8. [3]. Ahrén B. Effects of helospectin I on insulin and glucagon secretion in the mouse. Br J Pharmacol. 1991 Apr;102(4):916-8. [4]. Rai A, et al. Actions of Helodermatidae venom peptides and mammalian glucagon-like peptides on gastric chief cells. Am J Physiol. 1993 Jul;265(1 Pt 1):G118-25.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
VEGFA Antibody
COX2/Cyclooxygenase 2 Antibody
Phospho-Creb (Ser133) Antibody: Phospho-Creb (Ser133) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 35 kDa, targeting to Phospho-Creb (S133). It can be used for WB,ICC,IHC-P,IP,FC assays with tag free, in the background of Human, Mouse.

Share this post on:

Author: DNA_ Alkylatingdna