Share this post on:

Product Name :
GLP-1 moiety from Dulaglutide

CAS NO. :
923950-08-7

Formula :
C149H221N37O49

Molecular Weight::
3314.57

Target:
GCGR

Serial Number:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly

Short serial number :
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG

Purity:
95%

Description :
GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1.

References:
[1]. Chang W, et al. Glucagon-like peptide-1 receptor agonist dulaglutide prevents ox-LDL-induced adhesion of monocytes to human endothelial cells: An implication in the treatment of atherosclerosis. Mol Immunol. 2019 Dec;116:73-79. [2]. Hertzel C Gerstein, et al. Dulaglutide and cardiovascular outcomes in type 2 diabetes (REWIND): a double-blind, randomised placebo-controlled trial. Lancet [3]. Byrd RA, et al. Chronic Toxicity and Carcinogenicity Studies of the Long-Acting GLP-1 Receptor AgonistDulaglutide in Rodents. Endocrinology. 2015 Jul;156(7):2417-28.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
CD99 Antibody
Survivin Antibody (YA045)
Dynactin Subunit 1 Antibody (YA869): Dynactin Subunit 1 Antibody (YA869) is an unconjugated, approximately 142 kDa, mouse-derived, anti-Dynactin Subunit 1 (YA869) monoclonal antibody. Dynactin Subunit 1 Antibody (YA869) can be used for: WB, IP expriments in human background without labeling.

Share this post on:

Author: DNA_ Alkylatingdna