Share this post on:

Product Name :
RVG-9R

CAS NO. :
1678417-57-6

Formula :
C201H334N82O55S2

Molecular Weight::
4843.45

Target:
RABV

Serial Number:
Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH

Short serial number :
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR

Purity:
95%

Description :
Chimeric rabies virus glycoprotein fragment peptide (RVG-9R peptide) was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. Repeated administration of RVG-9R-bound siRNA did not induce inflammatory cytokines nor anti-peptide antibodies.It is a peptide extracted from the rabies virus glycoprotein (RVG). Since neurotropic viruses infect brain cells across the blood-brain barrier, the same strategy could be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA to bind, this chimeric peptide is synthesized by adding a non-Amer arginine residue to the carboxyl terminus of RVG. The RVG-9R peptide binds and transduces siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. Rvg-9r provides a safe, non-invasive method for delivering siRNA and other therapeutic molecules across the blood-brain barrier.

References:
[1]. Rassu G, et al. Nose-to-brain delivery of BACE1 siRNA loaded in solid lipid nanoparticles for Alzheimer’s therapy. Colloids Surf B Biointerfaces. 2017 Apr 1;152:296-301. [2]. Margus H, et al. Cell-penetrating peptides as versatile vehicles for oligonucleotide delivery. Mol Ther. 2012 Mar;20(3):525-33.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Phospho-RSK1 p90 (Ser380) Rabbit mAb Autophagy
Phospho-TAK1 (Ser439) Rabbit mAb custom synthesis
AMPK alpha 1 Antibody (YA624): AMPK alpha 1 Antibody (YA624) is a non-conjugated and Rabbit origined monoclonal antibody about 64 kDa, targeting to AMPK alpha 1. It can be used for WB,ICC/IF,FC,IP assays with tag free, in the background of Human, Rat.

Share this post on:

Author: DNA_ Alkylatingdna