TAT-NSF700 Fusion Peptide | DNA_ Alkylatingdna-alkylating.com

Product Name :
TAT-NSF700 Fusion Peptide

CAS NO. :

Formula :
C188H318N62O45

Molecular Weight::
4166.92

Target:

Serial Number:
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Leu-Asp-Tyr-Val-Pro-Ile-Gly-Pro-Arg-Phe-Ser-Asn-Leu-Val-Leu-Gln-Ala-Leu-Leu-Val-Leu

Short serial number :
YGRKKRRQRRRGGGLLDYVPIGPRFSNLVLQALLVL

Purity:
95%

Description :
It is a N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide, which is fused from the 11 amino acid cell permeable HIV transactivation regulatory protein (TAT) domain to the 22 amino acid NSF domain. TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.

References:
[1].Matsushita, K. et al. Mol. Pharmacol. 67,1137 (2005).

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
YB1 Antibody
Catalase Antibody (YA552)
Phospho-CREB (Ser133) Antibody (YA209): Phospho-CREB (Ser133) Antibody (YA209) is a non-conjugated and Rabbit origined monoclonal antibody about 35 kDa, targeting to Phospho-CREB (Ser133). It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Rat.

Author: DNA_ Alkylatingdna

Related Posts