Share this post on:

Product Name :
GHRF, bovine

CAS NO. :
88894-91-1

Formula :
C220H366N72O66S

Molecular Weight::
5107.88

Target:
GHSR

Serial Number:
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2

Short serial number :
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Purity:
≥95%

Description :
GHRF, bovine is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone.

References:
[1]. Padmanabhan V, et al. Modulation of growth hormone-releasing factor-induced release of growth hormone from bovine pituitary cells. Domest Anim Endocrinol. 1987 Oct;4(4):243-52. [2]. Zhao FQ, et al. Regulation of the gene expression of glucose transporter in liver and kidney of lactating cows by bovine growth hormone and bovine growth hormone-releasing factor. J Dairy Sci. 1996 Sep;79(9):1537-42.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Phospho-MEK1 (Thr292) Antibody
VEGFA Antibody
ISG15 Antibody: ISG15 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 18 kDa, targeting to ISG15. It can be used for WB assays with tag free, in the background of Human.

Share this post on:

Author: DNA_ Alkylatingdna